Biomedical subjects

H Neven

Publications and source records attributed to H Neven.

5 recordsLinked to original sources

PubMed2003

Bioflavoring and beer refermentation.

Various techniques are used to adjust the flavors of foods and beverages to new market demands. Although synthetic flavoring chemicals are still widely used, flavors produced by biological methods (bioflavors) are now more and more requested by consumers, increasingly concerned with health and environmental problems caused by synthetic chemicals. Bioflavors can be extracted from plants or produced with plant cell cultures, microorganisms or isolated enzymes. This Mini-Review paper gives an overview of different systems for the microbial production of natural flavors, either de novo, or starting with selected flavor precursor molecules. Emphasis is put on the bioflavoring of beer and the possibilities offered by beer refermentation processes. The use of flavor precursors in combination with non-conventional or genetically modified yeasts for the production of new products is discussed.

Beer↗

PubMed1996

Isolation of NEB-LFamide, a novel myotropic neuropeptide from the grey fleshfly.

A methanolic extract of 350,000 adult grey fleshflies Neobellieria bullata, was prepared and screened for myotropic activity. After fractionation on the first column, all fractions were screened in two heterologous (Locusta oviduct and Leucophaea hindgut) and one homologous (Neobellieria hindgut) myotropic bioassay. We here report the purification of one fraction, which stimulates the contractions of the Locusta oviduct. Electrospray Mass Spectrometry of the peptide revealed a molecular mass of 1395.82. The primary structure has been determined as AYRKPPFNGSLF-amide. This novel peptide was designated Neb-LF-amide. This sequence is different from the other known myotropic peptides in insects. The threshold concentration of the synthetic peptide is 1 x 10(-7) M on the Locusta oviduct. On the hindgut of Neobellieria or Leucophaea, the synthetic peptide is not active. By use of a polyclonal antiserum raised against the synthetic peptide, immunoreactivity was localized in median neurosecretory cells in the pars intercerebralis of the fly brain, indicating that Neb-LF-amide is a neuropeptide.

Amino Acid Sequence↗

PubMed1996

Isolation and identification of a cAMP generating peptide from the flesh fly, Neobellieria bullata (Diptera: Sarcophagidae).

The Manduca sexta Malpighian tubule assay system, developed to monitor adenylate cyclase activity, was used in combination with HPLC to isolate a novel cAMP generating peptide from 350,000 whole flesh flies, Neobellieria bullata. Mass spectrometry revealed a molecular mass of 5,047 daltons, and Edman degradation the following sequence: AGAEAEKLSGLSKYFNGTTMAGRANVAKATYAVIGLIIAYNVMKPKKK. This 48-mer peptide, called Neb-cGP, does not belong to the corticotropin releasing factor family of insect diuretic peptides. Electrophoresis and subsequent immunoblotting of peptides immunoprecipitated from a homogenate of entire flies showed that one fly contained approximately 0.003 to 0.03 micrograms Neb-cGP and that 10 micrograms represents the lowest immunostainable amount on a Western blot.

Amino Acid Sequence↗

PubMed1993

Isolation, identification, and synthesis of AKH-I4-10 from Locusta migratoria.

A heptapeptide was isolated from brain-corpora cardiaca-corpora allata-suboesophageal ganglion extracts of the locust, Locusta migratoria. Biological activity was monitored during HPLC purification by observing the myotropic effect of column fractions on the isolated hindgut of Leucophaea maderae. The primary structure of this myotropic peptide was established as: Phe-Thr-Pro-Asn-Trp-Gly-Thr-NH2. The chromatographic and biological properties of the synthetic peptide were the same as those of the native peptide, thus confirming structural analysis. This heptapeptide is identical to the carboxyterminal heptamer of AKH-I and therefore designated as AKH-I4-10. AKH-I4-10 has no adipokinetic activity. AKH-I4-10 is most likely a breakdown product of Lom-AKH-I, suggesting that an endopeptidase which cleaves between Asn and Phe is present in the brain complex of L. migratoria. Such an endopeptidase has recently been characterized in in synaptic membranes of the nervous system of Schistocerca gregaria.

Amino Acid Sequence↗

PubMed1992

Rate coherence and event coherence in the visual cortex: a neuronal model of object recognition.

We propose a function-oriented model of the visual cortex. The model addresses an essential task of the visual system: to detect and represent objects. These are defined as sets, which reappear in the input with invariant inner relations. A network, incorporating an idealized description of anatomical and physiological data, is presented with a movie showing various moving objects. In the course of time, as a result of Hebbian plasticity, a connection scheme develops which embodies in its forward and lateral connections the information necessary to perform the operations involved in object recognition. We demonstrate that coherent neural activity can exploit this information. Two types of coherence have to be distinguished in this respect. Rate coherence performs invariance operations and association, while event coherence accomplishes segmentation tasks. The model reproduces and explains experimental findings made both in physiological recordings from the visual cortex and in psychophysical studies.

Animals↗