PubMed Health⌕ Search

Biomedical subjects

J Ausió

Publications and source records attributed to J Ausió.

At least 37 records · Page 2Linked to original sources
PubMed1998

Histone H1 binding does not inhibit transcription of nucleosomal Xenopus laevis somatic 5S rRNA templates.

It has long been proposed that selective binding of histone H1 is, in part, responsible for the differential developmental regulation of the oocyte and somatic 5S rRNA genes in Xenopus laevis. In this study we show that histone H1 binds both oocyte and somatic genes equally after reconstitution into mononucleosomes or oligonucleosome arrays. Furthermore, we show that the binding of histone H1 selectively represses only oocyte gene transcription and that an RNA polymerase III transcription complex is able to initiate transcription of nucleosomal somatic templates regardless of whether histone H1 is present. These results support a model in which the differential regulation of the 5S rRNA genes is not simply due to the prevention of histone H1 binding by transcription complexes on the somatic genes, but rather to a difference in the histone H1 interaction with the somatic and oocyte genes.

Acetylation↗
PubMed1998

Folding of chromatin in the presence of heterogeneous histone H1 binding to nucleosomes.

We have reconstituted oligonucleosome complexes containing histone H1 starting from a synthetic DNA template, consisting of 12 tandemly arranged 208-base pair fragments of the 5 S rRNA gene, purified HeLa histone octamers, and histone H1. A ratio of histone H1 per histone octamer used in the reconstitution (0.8-0.9 mol of histone H1/mol of histone octamer) similar to that observed in vivo was used. The reconstituted chromatin complexes exhibit a salt-dependent folding, which is almost indistinguishable from that exhibited by chromatin fragments obtained from nuclease digestion of native chromatin. The folding of this reconstituted chromatin complex seems to be rather independent of the symmetrical or asymmetrical position occupied by H1 in the individual nucleosomes. Binding of histone H1 to the oligonucleosome complexes, under the stoichiometric binding conditions used, had no inhibitory effect on the transcriptional potential of these complexes.

Animals↗
PubMed1998

Reconstitution of chromatin complexes from high-performance liquid chromatography-purified histones.

We describe a method to reconstitute chromatin complexes from reversed-phase high-performance liquid chromatography (HPLC)-purified histones. The complexes reconstituted in this way exhibit the same structural characteristics as their equivalent native counterparts. Furthermore, this method works independently of the acid- or salt-extracted origin of the histones used for the HPLC fractionation. The potential of this method for the reconstitution of chromatin particles consisting of sequence-defined DNA templates and well-defined histone variants and/or their posttranslationally modified isoforms is discussed.

Biochemistry↗
PubMed1998

Nucleosome translational position, not histone acetylation, determines TFIIIA binding to nucleosomal Xenopus laevis 5S rRNA genes.

We sought to study the binding constraints placed on the nine-zinc-finger protein transcription factor IIIA (TFIIIA) by a histone octamer. To this end, five overlapping fragments of the Xenopus laevis oocyte and somatic 5S rRNA genes were reconstituted into nucleosomes, and it was subsequently shown that nucleosome translational positioning is a major determinant of the binding of TFIIIA to the 5S rRNA genes. Furthermore, it was found that histone acetylation cannot override the TFIIIA binding constraints imposed by unfavorable translational positions.

Acetylation↗
PubMed1997

Reconstitution of native-like nucleosome core particles from reversed-phase-HPLC-fractionated histones.

We have reconstituted nucleosome core particles from reversed-phase-HPLC-purified chicken erythrocyte core histones and 145 bp random-sequence DNA fragments. Characterization of the resulting nucleoprotein complexes by sedimentation velocity, CD and DNase I footprinting showed that they are structurally indistinguishable from native nucleosome core particles. Furthermore, we have shown that the ability to reproduce these native-like structural features in these reconstituted nucleosome core particles is basically independent of the biological source or the method used (i.e. salt versus acid) for the extraction of histones before their HPLC fractionation. The usefulness and relevance of this approach for the reconstitution of native-like chromatin structures from histone types (histone variants/post-translationally modified histones), which are usually available only in relatively small amounts, is discussed.

Animals↗
PubMed1997

Major role of the histones H3-H4 in the folding of the chromatin fiber.

We have characterized the hydrodynamic behavior of nucleosome arrays in which the N- and C-terminal "tails" of the histone H2A-H2B and H3-H4 domains have been selectively removed by digestion with immobilized trypsin. The sedimentation coefficient of the polynucleosome fibers lacking the histone H2A-H2B tails exhibited a salt dependence close to that of the non-trypsinized nucleosome arrays. In contrast, the salt-dependent behavior of the H3-H4-trypsinized polynucleosome fibers was found to be closer to that observed for the nucleosome arrays on which all the histones were trypsinized. This indicates that the N- and C-terminal domains of histones H3-H4 play a major role in the folding of the chromatin fiber. Magnesium titration of the polynucleosome fibers consisting of these trypsinized histone octamer hybrids at low ionic strength indicates that the histone H3-H4 tails also play an important role in the association of the polynucleosome fibers. These findings suggest that, after linker histones (histones of the H1 family), the tails of the histone H3-H4 domains are the major players in the processes that lead to the intra-association (folding) and inter-association of the chromatin fiber.

Animals↗
PubMed1997

Sperm nuclear basic proteins (SNBPs) of agnathans and chondrichthyans: variability and evolution of sperm proteins in fish.

We have characterized for the first time SNBPs from the hagfish Eptatratus stouti (Myxini) and the lamprey Lampetra tridentatus (Cephalaspidomorphi) and have found that histones are the major protein components of the sperm of these agnathans. We have also conducted a systematic analysis of SNBPs from different groups of chondrichthyan fishes, including the skate Raja rhina and seven species of sharks. Together with our previous data showing the sporadic nature of SNBP evolution in bony fish (Saperas, N., Ausio, J., Lloris, D. and Chiva, M. [1994] J. Mol. Evol. 39: 282-295), the present study provides a unique insight into the overall evolutionary complexity and variability of the nuclear sperm proteins of fishes. It would appear that despite the discontinuous evolution of these proteins, the macroevolutionary pattern of histone (H type) --> protamine-like (PL type) --> protamine (P type) has been conserved in fish evolution, as it has in the evolution of other Deuterostomes.

Amino Acid Sequence↗
PubMed1997

The sperm nuclear basic proteins (SNBPs) of the sponge Neofibularia nolitangere: implications for the molecular evolution of SNBPs.

We have isolated and characterized for the first time, the SNBPs from an organism (Neofibularia nolitangere) of the phylum Porifera (Sponges). We have shown that these proteins consist of histones which, as expected, exhibit an amino acid composition very similar to that of other eukaryotic histones. The finding of histones in the sperm of these primitive organisms provides support to the notion that histones (SNBPs of the histone, H, type) were the proteins present at the onset of SNBP evolution. In contrast, a discrete number of alternative SNBP types (protamine-like, PL; protamine, P, types) seem to have appeared later on in the course of evolution and are found in both protostomes and deuterostomes, most likely as a result of processes of parallel evolution.

Amino Acids↗
PubMed1997

Relationship between chromatin high-order folding and nucleosomal linker twist in nuclei of human HeLa s3 cells.

We have used the intercalative agent ethidium bromide to examine the association between chromatin high-order folding and the twist of internucleosomal DNA regions. The analysis was carried out on intact nuclei isolated from human HeLa S3 cells. Our data shows that alterations in the nucleosomal linker twist significantly influence the way in which a chain of nucleosomes folds to form different higher-order structures. The assay used allowed us to identify the existence of two chromatin fractions differing in their extent of high-order folding. We have also found that active gene sequences are preferentially associated with the chromatin fraction corresponding to the more extended conformation. A model is proposed to account for the effect of variations in the nucleosome linker twist on the state of chromatin folding.

Cell Nucleus↗
PubMed1996

Protamines of reptiles.

We have characterized for the first time the complete primary structure of the main protamine components of the sperm from four reptiles: Chrysemys picta (turtle), Elaphe obsoleta (snake), Anolis carolinensis (lizard), and Alligator mississipiensis (crocodilian). These species were chosen to represent one of each of the main phylogenetic branches of this taxonomic group. Comparison of these protamine sequences with those already available from other vertebrate groups allows us to define properly the chemical consensus composition of protamines and provides a unique insight into their molecular evolution and classification.

Alligators and Crocodiles↗
PubMed1996

Modulation of the higher-order folding of chromatin by deletion of histone H3 and H4 terminal domains.

The 'tails' of histones H3 and H4 were removed by light in situ trypsin digestion of the nuclei. The alterations in the higher-order folding of chromatin resulting from this treatment were monitored by ethidium bromide titration. We found that DNA-intercalation of ethidium bromide under these conditions exhibited a complex concentration effect that was dependent on the extent of chromatin folding. This most likely reflects the structural transitions of chromatin during its folding as a result of the changes in the nucleosome linker twist [Woodcock, Grigoryev, Horowitz and Whitaker (1993) Proc. Natl. Acad. Sci. U.S.A. 90, 9021-9025]. These results strongly suggest that the H3 and H4 terminal domains play a very important role in chromatin folding. We discuss the molecular basis of this phenomenon and propose a novel generalized model for the higher-order folding of chromatin.

Cell Nucleus↗
PubMed1993

Chromatin fibers with different protamine and histone compositions.

Previous studies have established that chromatin fibers which contain histones have variable diameters in different biological materials. In this paper we show that chromatin fibers are also present in spermatozoa and spermatids of bivalve molluscs in which some or all histones have been replaced by protamines. In all cases thick chromatin fibers are formed, with a diameter in the range 25-50 nm, depending on the species. We conclude that the formation of chromatin fibers is determined by the partial neutralization of the DNA charges with any histone or protamine, rather than due to a precise association of nucleosomes. This conclusion is in agreement with current theoretical work which shows that the diameter of complexes of DNA with counterions is determined by an overall balance of the interaction forces present.

Animals↗
PubMed1991

Primary, secondary, and tertiary structure of the core of a histone H1-like protein from the sperm of Mytilus.

We have analyzed the structure of the trypsin-resistant core of the protein PL-II* of the sperm from Mytilus californianus. The peptide has a molecular mass of 8436 Da and its primary sequence is ATGGAKKP STLSMIVAAIQAMKNRKGSSVQAIRKYILANNKG INTSRLGSAMKLAFAKGLKSGVLVRPKTSAGA SGATGSFRVG. This sequence bears an enormous homology and fulfills the constraints of the consensus sequence of the trypsin-resistant peptides of the proteins of the histone H1 family. Secondary structure analysis using Fourier-transform infared spectroscopy as well as predictive methods indicate the presence of 20-30% beta-structure and approximately 25% alpha-helix for this peptide. As in the case of histone H1 proteins, the protein PL-II* core exhibits a compact globular structure as deduced from hydrodynamic measurements. The presence of a histone H1 protein with protamine-like features, seems to be thus, a common general feature of the chromatin composition in the sperm of the bivalve molluscs.

Amino Acid Sequence↗
PubMed1988

An unusual cysteine-containing histone H1-like protein and two protamine-like proteins are the major nuclear proteins of the sperm of the bivalve mollusc Macoma nasuta.

The sperm-specific protamine-like (PL) components PL-I, PL-II, and PL-III from the sperm of the bent-nose clam Macoma nasuta have been isolated and characterized for the first time. These proteins coexist in the sperm nuclei with a small percentage of a full histone complement. All of them have a very similar amino acid composition, following what seems to be the general composition prototype for the class Bivalvia (Ausió, J. (1986) Comp. Biochem. Physiol. B Comp. Biochem. 85, 439-449). Nevertheless, they have different molecular weights (PL-I = 23,500, PL-II = 15,600, and PL-III = 7,900) as measured by sedimentation equilibrium in the analytical ultracentrifuge. Furthermore, the PL-I component shares common features with the proteins of the histone H1 family. Yet, it is very unusual, for it contains 2 cysteine residues that are located in the trypsin-resistant core of this protein. The protamine-like fraction PL-III exhibits intraspecific microheterogeneity which is reflected by the presence of two protein variants which most probably are the result of an allelic polymorphism.

Amino Acids↗
PubMed1988

Histone hyperacetylation. Its effects on nucleosome core particle transitions.

Effects of histone hyperacetylation on transitions of HeLa cell nucleosome core particles were studied. The transitions examined were induced by low salt concentrations, pH, temperature, and nondissociating high salt. Effects of salt dissociation were also examined. The low-salt transition was found to shift to higher ionic strength by approximately three fold for hyperacetylated particles, a change which may be due simply to the increased overall negative charge on the particles caused by acetylation of lysine residues. Some differences were also seen in the way in which core particles refold after exposure to very low salt (which induces a nonreversible change in the particles). Otherwise no significant effects of hyperacetylation were observed.

Acetylation↗
PubMed1983

Structural heterogeneity of reconstituted complexes of DNA with typical and intermediate protamines.

The binding of the intermediate proteins phi 1 and phi 3 from the mussel Mytilus edulis to DNA was studied in comparison with the typical protamine from the squid Loligo vulgaris using precipitation curves, thermal denaturation and X-ray diffraction techniques. The properties of protein phi 1 appear to be very close to those of typical protamines while the properties of protein phi 3 are notably different. The method of reconstitution influences the structural properties of the complexes. This effect is most pronounced in the case of protein phi 3. The structural heterogeneity of the protein component in the complexes is discussed in the light of these observations.

Animals↗
PubMed1982

Conformational study and determination of the molecular weight of highly charged basic proteins by sedimentation equilibrium and gel electrophoresis.

We study several highly charged protamines and some related proteins from the sperm of molluscs. Circular dichroism and hydrodynamic parameters obtained from the sedimentation constant and intrinsic viscosity show that these proteins behave as random coils. However, it appears that a small amount of structure is present at basic pH. The molecular weight of these proteins is determined by several methods. When sedimentation equilibrium is used, we have found that the influence of concentration is much smaller than expected. We have also found that the highly charged nature of these proteins can be properly taken into account by using the methodology presently available [Williams, J. W., Van Holde, K. E., Baldwin, R.L., & Fujita, H. (1958) Chem. Rev. 58, 715; Eisenberg, H. (1976) Biological Macromolecules and Polyelectrolytes in Solution, Oxford University Press, London]. The calculations have been carried out in most cases by the method of Chernyak & Margretova [Chernyak, V. Ya., & Margretova, N.N. (1975) Biochem. Biophys. Res. Commun. 65, 990], which does not require the knowledge of the protein concentration. The overall adequacy of this approach has been ascertained by using as standards histone H1 and the protamine thynnine, both of known molecular weight and different charge densities. An electrophoretic method for the rapid estimation of the molecular weights of this type of proteins is also given. The values obtained by this method, as well as those found either with the Scheraga-Mandelkern equation or from the sedimentation and diffusion constants, agree within experimental error with the values obtained from sedimentation equilibrium.

Animals↗