Effect of ischemia on median and ulnar motor nerve conduction velocities at various temperatures.
Explore the source record for details and available documents.
Adolescent↗
Biomedical subjects
L S Chu
Publications and source records attributed to L S Chu.
Effect of ischemia on latencies of the median nerve in the hand at various temperatures.
Explore the source record for details and available documents.
Action Potentials↗
Latency changes in distal median nerve produced by alterations in ambient temperatures.
Explore the source record for details and available documents.
Adult↗
Physiologic and clinical basis for histamine by ion transfer.
Explore the source record for details and available documents.
Adult↗
Effect of tissue temperatures and blood flow on motor nerve conduction velocity.
Explore the source record for details and available documents.
Blood Flow Velocity↗
Vascular basis for pain due to cold.
Explore the source record for details and available documents.
Adult↗
Purification of peptide hormones from chinchilla pancreas by chemical assay.
Glucagon was purified from chinchilla pancreas and its biological activity determined. It was isolated using a chemical assay to identify peptides with a histidyl residue at the N-terminus. Chinchilla glucagon has the amino acid sequence HSQGTFTSDYSKHLDSRYAQEFVQWLMNT. It differs from the usual mammalian glucagon by amino acid substitutions at positions 13, 18 and 21 from the N-terminus. Despite these sequence changes, its biological activity is conserved. Chinchilla glucagon has approximately the same potency as pig glucagon in stimulating liver membrane adenyl cyclase activity. Pancreatic polypeptide was also purified from chinchilla pancreas based on its Ala1 signal and has the sequence APLEPVYPGDNATPEQMAQYAAEMRRYINMLTRPRY#.
Adenylyl Cyclases↗