PubMed Health⌕ Search

Biomedical subjects

M Irie

Publications and source records attributed to M Irie.

At least 199 records · Page 11Linked to original sources

Purification of acid ribonucleases from bovine spleen.

Two acid RNases were purified from bovine spleen by means of ammonium sulfate fractionation, chromatographies on-phospho-cellulose, heparin-Sepharose CL-6B, poly G-Sepharose, and 2', 5'-ADP-Sepharose, and gel filtration on Toyopearl HW 55F. Both purified preparations were homogeneous as judged by disc electrophoresis at pH 4.3. They were designated as RNase BSP1 and RNase BSP2 in the order of elution from a phospho-cellulose column. RNase BSP2 was immunologically indistinguishable from RNase K2 from bovine kidney. RNase BSP1 was a typical pyrimidine base-specific, uridylic acid-preferential RNase and had very sharp pH optimum at 6.5. RNase BSP1 thus obtained was a glycoprotein giving two major bands on SDS-slap electrophoresis. Although the apparent molecular weight of RNase BSP1 was distributed in the range of 27,000-20,000, it decreased to about 17,000-18,000 after endoglycosidase F digestion. The N-terminal amino acid sequence up to the 20th amino acid had no homology to those of RNase K2 and RNase A.

Amino Acids↗

Primary structure of a base non-specific ribonuclease from Rhizopus niveus.

The primary structure of a base non-specific ribonuclease from Rhizopus niveus (RNase Rh) was determined by nucleotide sequence analysis of the DNA fragment encoding RNase Rh gene including signal peptide sequence, and amino acid sequence analysis of the peptide obtained from RNase Rh and RNase Rh' (a protease-modified RNase Rh created during the course of purification). The sequence determined was: MKAVLALATLIGSTLASSCSSTA LSCSNSANSDTCCSPEYGLVVLNMQWAPGYGPANAFTLHGLWPDKCSGAYAPSGGCDSN RASSSIASVIKSKDSSLYNSMLTYWPSNQGNNNVFWSHEWSKHGTCVSTYDPDCYDNYE EGEDIVDYFQKAMDLRSQYNVYKAFSSNGITPGGTYTATEMQSAIESYFGAKAKIDCSSG TLSDVALYFYVRGRDTYVITDALSTGSCSGDVEYPTK (the sequence of signal peptide is underlined). The sequence indicates that the homology with the sequence of RNase T2 from A. oryzae with the same base specificity is about 42% and that the sequences around the two histidine residues which are supposed to be involved in the active site are fairly conserved.

Amino Acid Sequence↗

Primary structure of a non-secretory ribonuclease from bovine kidney.

The primary structure of a non-secretory ribonuclease from bovine kidney (RNase K2) was determined. The sequence determined was VPKGLTKARWFEIQHIQPRLLQCNKAMSGV NNYTQHCKPENTFLHNVFQDVTAVCDMPNIICKNGRHNCHQSPKPVNLTQCNFIAGRYPDC RYHDDAQYKFFIVACDPPQKTDPPYHLVPVHLDKYF. The sequence homology with human non-secretory RNase, bovine pancreatic RNase, and human secretory RNase are 46, 34.6, and 32.3%, respectively. The bovine kidney RNase has two inserted sequences, a tripeptide at the N-terminus and a heptapeptide between the 113th and 114th position of bovine pancreatic RNase; on the other hand, it is deleted of the hexapeptide consisting of the 17th to the 22nd amino acid residue of RNase A. The amino acid residues assumed to be the constituents of the bovine pancreatic RNase active site are all conserved except F120 (L in RNase K2).

Amino Acid Sequence↗

Primary structure of a ribonuclease from bovine brain.

The primary structure of a pyrimidine base-specific ribonuclease from bovine brain was determined. The sequence determined is (sequence; see text). Although the sequence homology of this RNase with bovine pancreatic RNase A is 78.2%, it consists of 140 amino acid residues, and it is 16 amino acid residues longer than RNase A at the carboxyl-terminal. In addition to an N-glycosylated long carbohydrate chain, the bovine brain RNase has two short O-glycosylated carbohydrate chains at the 129th and the 133rd serine residues. The additional C-terminal tail of the bovine brain RNase has a unique composition: 6 proline, 5 hydrophobic amino acids, and two basic amino acids, arginine and histidine.

Amino Acid Sequence↗

Effect of load-cycling on bond between composite fillings and dentin established by Gluma and various resins.

Cylindrical dentin cavities, pretreated with Gluma and various resins, were filled with Silux, P-30, or Concise. Marginal integrity was in most instances obtained when experimental resins containing propionic aldehyde were used. The bond between composite and dentin established in this way was tested by load-cycling. Cervical located cavities in extracted human teeth, approximately one-half of the margins in dentin, were etched and treated as above. Fillings made of Silux, P-30, or Concise exhibited margins without stain upon axial loading in most cases. The frequency of staining increased when Dycal was used as cavity liner, but were absent in all cases when Concise was used as filling material. The content of propionic aldehyde in the intermediary resin layer may reduce the oxygen tension at the interface and thereby increase the rate of the polymerization at this location.

Acrylic Resins↗

[Tri-disk method].

Explore the source record for details and available documents.

Anti-Bacterial Agents↗

[The mode of delivery and neonatal outcome in breech presentations less than 32 weeks' of gestation].

This study was undertaken to determine the effect of the delivery method on neonatal outcome in fetal breech presentation, and the following results were obtained. The rate of cesarean section for breech presentations was 70.7% (104/147). 1) There were 18 neonatal deaths (41.9%) in 43 vaginal breech deliveries compared to 8 (7.7%) in 104 cesarean breech deliveries. Neonatal deaths were significantly higher in vaginal breech deliveries than cesarean breech deliveries (p less than 0.001). 2) In breech presentations, intracranial hemorrhages were more common among vaginally born infants (44.2% vs. 25.0%; p less than 0.02), but the incidence of idiopathic respiratory distress syndrome (39.5% vs. 28.8%) did not differ significantly between vaginal and cesarean infants. 3) In singletons delivered vaginally, fetal distress was more common among breech presentations than vertex presentations (83.3% vs. 46.3%; p less than 0.02). 4) In vaginally delivered breech singletons, there was no neonatal death among infants with more than 4 one minute Apgar scores, and there was no significant difference between neonatal death and the no neonatal death groups with regard to gestational weeks and birth weight.

Breech Presentation↗

Acute suppression of endogenous testosterone levels by exogenous testosterone in normal men.

The effect of exogenous testosterone on endogenous plasma testosterone was studied in normal men. Intramuscularly administered testosterone-19,19,19-d3 rapidly appeared in the systemic circulation in large amounts. Endogenous plasma testosterone was suppressed to near-castrate levels. The suppressed level began to rise between 6 and 10 h, and reached a preinjection level at 24 h after the injection. Plasma LH decreased with a concomitant decrease in endogenous testosterone and began to rise as soon as plasma total testosterone returned to physiological levels.

Adult↗

The carbohydrate moieties of human urinary ribonuclease UL.

Ribonuclease UL purified from pooled human urine contains approximately 20.7% of neutral sugar and 7.8% of aminosugar. All sugars were quantitatively released as oligosaccharides on hydrazinolysis. The oligosaccharides were converted to tritium-labeled oligosaccharides on reduction with NaB3H4. The radioactive oligosaccharide fraction was separated into a neutral and an acidic fraction on paper electrophoresis. All oligosaccharides in the acidic fraction could be converted to neutral oligosaccharides with the release of one sialic acid residue by sialidase digestion. Both fractions were shown to be mixtures of more than fourteen oligosaccharides by gel permeation chromatography. Structural studies on these oligosaccharides involving sequential exoglycosidase digestion in combination with methylation analysis revealed that ribonuclease UL contains sialylated and non-sialylated mono, bi-, tri-, and tetraantennary complex type sugar chains with N-acetyllactosamine outer chains, and tri- and tetraantennary complex type sugar chains with various numbers of Gal beta 1----4GlcNAc beta 1----3Gal beta 1----4GlcNAc beta 1----outer chains. An important finding was that all sialic acid residues in the acidic oligosaccharides only occur as the Sia alpha 2----6Gal beta 1----4GlcNAc beta 1----2Man alpha 1----3 group. Both fucosylated and non-fucosylated trimannosyl cores were found among the asparagine-linked sugar chains of ribonuclease UL.

Carbohydrates↗

Dentin-polymer bond established by Gluma and tested by thermal stress.

The walls of cylindrical cavities in human dentin were treated with Gluma and various resins before filling with either a microfilled or a macrofilled composite (Silux, P-30 or Concise). The extent of gaps (crevices) along the tooth/filling interface was observed before and after thermal cycling at restorations polished either 10 min or 24 h after curing of the composite. Application of a resin containing polymerization initiators and 1% propanal before filling with Silux or Concise resulted in restorations without contraction gaps along the tooth/filling interface. When P-30 was used in this procedure, one of six of the fillings exhibited gaps, but none of the six did so when removal of the marginal excess was postponed for 24 h.

Aldehydes↗

Plasma growth hormone (GH) response to GH-releasing factor (SM-8144) in children of short stature and patients with GH deficiency.

Synthetic human GRF (hGRF (1-44) NH2; SM-8144) was administered as an iv bolus to 141 normal children of short stature (NSC), 73 patients with severe idiopathic GH deficiency (IGD; group A), 30 patients with mild idiopathic GH deficiency (IGD; group B), 29 patients with secondary GH deficiency, 3 patients with primary hypothyroidism, 21 patients with Turner's syndrome and 25 patients with various other disease. Their height was below normal for their age and sex, and they were all below 25 years old without obesity. The maximal GH responses (M+SEM) were 39.5 +/- 2.2, 7.2 +/- 0.9, 27.2 +/- 3.7, 5.2 +/- 0.8, 9.7 +/- 4.4, 25.1 +/- 2.8 and 32.3 +/- 4.8 ng/ml, respectively (significance from the NSC, ; p less than 0.05, ; p less than 0.001). The GH responses to hGRF were greater than those elicited by standard pharmacological tests. There was a negative correlation between bone age and peak plasma GH response to hGRF in patients with idiopathic GH deficiency (IGD) but not in normal children (NSC). In twenty-two percent of the patients with IGD in group A the response was above 10 ng/ml and in 57% of the patients with IGD in group B the response was above 20 ng/ml, suggesting that a large percentage of patients with idiopathic GH deficiency lack hypothalamic GRF. The side effect of flushing was observed in 15.2% of all subjects. These results indicate the potential usefulness of hGRF (1-44) NH2 (SM-8144) in inducing GH release from the pituitary.

Adolescent↗