SEARCH · PubMed Health
Explore indexed PubMed citations for clinical trials, systematic reviews and public health research. Read source abstracts and follow each citation to its original PubMed record.
Quote a phrase for an exact phrase match. Source license links do not imply unrestricted reuse.
The genetic consequence of positive assortative mating for the demographic characters in the megapolis population is being discussed.
Ultrastructural analyses of cytoplasmic changes in Saccharomyces cerevisiae X2180-1A (MATa) that had been treated with alpha factor were performed by using the freeze-substitution fixation method. After alpha factor treatment, cells exhibited a pointed projection, which is a unique pattern of oriented cell surface growth. The relationship between projection formation and intracellular organelles was examined using serial thin sections and computer-aided three-dimensional reconstructions. Using these analyses membrane vesicles and other organelles were detected, and studies on their dynamic structural reorganization became feasible. Production of membrane vesicles (average 65 nm in diameter) was induced upon exposure of the cells to alpha factor before projection emergence. The total number of membrane vesicles increased at the early stage and decreased at the late stage of projection formation. Three-dimensional analysis indicated that the vesicles were at first dispersed throughout the cell, then accumulated at the site where the projection formed. Morphological changes and multiplication of the Golgi body were seen during the process of projection formation. Other intracellular organelles (nucleus, vacuole, rough endoplasmic reticulum and mitochondria) were also rearranged, showing a polar organization of the cytoplasm during projection formation.
Alpha-factor-mediated cell cycle arrest and mating inhibition of a mating-type cells of Saccharomyces cerevisiae have been examined in liquid cultures. Cell cycle arrest may be monitored unambiguously by the appearance of morphologically abnormal cells after administration of alpha factor, whereas mating inhibition is determined by comparing the mating efficiency in the absence or presence of added alpha factor. For both cell cycle arrest and mating inhibition, a dose-dependent response may be observed at limiting concentrations of the pheromone. If cell cycle arrest and mating inhibition require a small number of alpha-factor molecules, one might expect that responsive/nonresponsive cells = K(alpha factor)(N) where N is the order of dependence of cell cycle arrest (or mating inhibition) on alpha-factor concentration. The value of N has been determined to be 0.98 +/- 0.18 (standard error of the mean) for cell cycle arrest and 1.08 +/- 0.32 for mating inhibition. These results support the notion that saturation of a single site by alpha factor is sufficient to cause cell cycle arrest or mating inhibition of a mating-type cells.
Schizosaccharomyces pombe h+ cells secrete a diffusable mating pheromone called P-factor. Here we show that the map2 gene, a defect of which confers h(+)-specific sterility, encodes the precursor of P-factor. We purified P-factor from cells overexpressing map2 and determined its amino acid sequence. P-factor is a peptide of 23 residues, with the sequence Thr-Tyr-Ala-Asp-Phe-Leu-Arg-Ala-Tyr-Gln-Ser- Trp-Asn-Thr-Phe-Val-Asn-Pro-Asp-Arg-Pro-Asn-Leu. A synthetic peptide of this sequence gave the same specific activity and chromatographic profile as the purified P-factor, suggesting that P-factor is unmodified. h- cells starved for nutrition showed a morphological response to P-factor. Transcription of the sxa2 gene, which encodes a protease thought to degrade P-factor, was activated in these cells. The cry1 null mutant, which lacks adenylyl cyclase and has little intracellular cAMP, was susceptible to P-factor even in the presence of nutrients. Combination of the cyr1 and sxa2 mutations enhanced this susceptibility. P-factor induced not only responses toward mating but also arrest of the cell cycle at the G1 phase in h- cyr1 sxa2 cells. This proves that the S. pombe mating pheromone has the ability to arrest cell cycle progression, which has previously been obscured by the usual requirement for mating of nutritional starvation and subsequent growth arrest.
Saccharomyces cerevisiae MATa cells arrest cell division in response to the mating pheromone, alpha factor. After some interval of time the cells resume division. It is demonstrated here that cells recover from division arrest by becoming insensitive to the alpha factor under conditions of low cell density (10(2) cells/ml) where no alpha factor destruction occurs. The time of desensitization occurs later at higher alpha factor concentrations. Using the technique of perfusion photomicroscopy developed in this study, it was found that 95% of the desensitized cells remain insensitive to the alpha factor for greater than or equal to 3 generations at the alpha factor concentration where recovery occurred. Upon recovery, cells have generation times which are similar or identical to the calculated time from the cdc28 "start" step of cell division to cell separation. Therefore, the abnormally large recovered cells behave as if they have no growth time requirement for cell division for several generations. Desensitization was found to occur asymmetrically for parent and daughter cells. While parents (cells which have budded) are insensitive to alpha factor, their daughters (cells which have never budded and which were formed from desensitized parents during continuous perfusion with alpha factor) show 54% with a delayed generation time compared to control daughter cells.
Saccharomyces cerevisiae cells of a and alpha mating types constitutively secrete cell-specific peptide mating pheromones. a-Factor is secreted by a cells and acts on alpha cells, while alpha-factor is secreted by alpha cells and acts on a cells. Confirming preliminary studies, we demonstrate here that cultures of a cells contain higher than constitutive levels of a-factor activity when grown with alpha cells or alpha-factor. This induction of a-factor may result from increased synthesis or increased secretion of a-factor, as opposed to modification or stabilization of preexisting a-factor, as part of the a cell response to alpha-factor, as an a ste2 mutant (which cannot respond to alpha-factor) is not induced by alpha-factor. In mixed cultures inoculated with equal numbers of a cells and alpha cells, a cells predominate by stationary phase. Thus, a series of sequential interactions between a and alpha cells may be involved in establishing optimal hormone concentrations and cell ratios for conjugation.
Haploid cell-types of baker's yeast, Saccharomyces cerevisiae, secrete pheromones which are essential for conjugation. Recently a putative structure for the elusive a-factor pheromone has been reported. In this report we present a procedure to obtain a-factor from batch cultures of cells using hydrophobic Amberlite XAD-2 resin in the growth medium with subsequent differential washings of the resin with organic solvents. We have determined the biological activity of the a-factor preparation by verifying that there is an increase in transcription of the a-factor receptor gene, STE3, by Northern analysis of STE3 mRNA before and after exposure of the appropriate cell type to a-factor. Furthermore, a beta-galactosidase assay of the putative receptor gene fused to the lacZ gene, coding for beta-galactosidase (STE3-lacZ), was done to quantify the biological activity of the a-factor.
Mating type a cells of the yeast Saccharomyces cerevisiae produce a mating hormone, the a-factor, that we have previously characterized as a very hydrophobic, modified dodecapeptide (Betz, R., Crabb, J. W., Meyer, H. E., Wittig, R., and Duntze, W. (1987) J. Biol. Chem. 262, 546-548). We have investigated the molecular structure in detail using mass spectrometry and proton NMR spectrometry of the intact hormone and authentic component molecules. Tandem mass spectrometry confirms the previously determined peptide sequence of the hormone and shows that it contains additional structural components with masses of 205 and 15 daltons. These were identified by proton NMR and mass spectrometry as a farnesyl (C15H25) residue and a terminal methyl ester group. The farnesyl moiety is attached to the sulfur atom of the carboxyl-terminal cysteine residue, as revealed by NMR of synthetic S-farnesyl cysteine methyl ester. The stereochemical configuration of the farnesyl moiety was determined to be trans,trans by comparison of gas chromatography retention times, mass spectra, and NMR spectra with those of standards. These results define the structure of a-factor as: (Sequence: see text). Replacement of the farnesyl by a methyl group leads to a partial reduction in specific biological activity of the a-factor, whereas hydrolysis of the carboxyl-terminal methyl ester causes a complete loss of activity.
Carboxy-terminal processing of the mating pheromone alpha-factor of the yeast Saccharomyces cerevisiae has been assumed to be due to the action of carboxypeptidase ysc alpha [(1985) EMBO J. 4, 173-177]. Here it is shown that a mutant (kex1) defective in alpha-factor maturation is defective in carboxypeptidase ysc alpha activity, indicating that the enzyme is indeed the processing catalyst. It is proposed that carboxypeptidase ysc alpha is the product of the KEX1 gene.
Nine independent mutants which are supersensitive (ssl-) to G1 arrest by the mating hormone a-factor were isolated by screening mutagenized Saccharomyces cerevisiae MAT alpha cells on solid medium for increased growth inhibition with a-factor. These mutants carried lesions in two complementation groups, ssl1 and ssl2. Mutations at the ssl1 locus were mating type specific: MAT alpha ssl1- cells were supersensitive to a-factor but MATa ssl1- were not supersensitive to alpha-factor. In contrast, mutations at the ssl2 locus conferred supersensitivity to the mating hormone of the opposite mating type on both MAT alpha and MATa cells. The alpha-cell specific capacity to inactivate externally added a-factor was shown to be lacking in MAT alpha ssl1- mutants whereas MAT alpha ssl2- cells were able to inactivate a-factor. Complementation analysis showed that ssl2 and sst2, a mutation originally isolated as conferring supersensitivity to alpha-factor to MATa cells, are lesions in the same gene. The ssl1 gene was mapped 30.5 centiMorgans distal to ilv5 on chromosome XII.
The alpha-factor tridecapeptide initiates mating in Saccharomyces cerevisiae upon interaction with Ste2p, its cognate G-protein coupled receptor (GPCR). This interaction is being used as a paradigm for understanding the structure and mechanism of activation of GPCRs by medium-sized peptides. In this article, the use of fragments of Ste2p to study its structure is reviewed. Methods of synthesis of peptides corresponding to both extramembranous and transmembrane domains of Ste2p are evaluated and problems that are encountered during synthesis and purification are described. The results from conformational analyses of the peptide fragments using fluorescence spectroscopy, CD, infrared spectroscopy, and NMR spectroscopy in organic-aqueous mixtures and in the presence of detergent micelles and lipid bilayers are critically reviewed. The data obtained to date provide biophysical evidence for the structure of different domains of Ste2p and indicate that peptides corresponding to these domains have unique biophysical tendencies. The studies carried out on Ste2p fragments indicate that valuable information concerning the structure of the intact receptor can be obtained by studying peptide fragments corresponding to domains of these polytopic integral membrane proteins.
Routinely prepared gametes (by flooding 3 week-old agar cultures) showed about 80% mating competence if the opposite sexual partners were mixed together. The mating competence exhibited a strict dependence on the composition of the solution in which the cells were suspended before mixing; it decreased progressively with increasing concentration of nitrates. In contrast, no inhibiting effect was found if urea was used as the source of nitrogen. Other ions present in nutrient media did not show any effect. Mating activity varied according to the spectral composition of light, being higher with a blue light than with a red one. Blue light caused accumulation of vis-à-vis pairs, which were blocked to form zygotes. Freshly released daughter cells in vegetatively grown synchronous cultures had a dual nature--vegetative and sexual one. In these daughter cells, similar rules were found for governing of mating competence to those valid for standard gametes obtained from flooded agar cultures. High mating competence was found in daughter cells released the during dark period in distilled water, nitrate-free media, in the presence of Mg2+ or Ca2+ ions, or in media containing urea. The conditions during which daughter cells are released and the conditions under which they mate can be considered crucial for expression of gametic nature as a mating competence.
Explore the source record for details and available documents.
The Ste2p receptor for alpha-factor, a tridecapeptide mating pheromone of the yeast Saccharomyces cerevisiae, belongs to the G protein-coupled family of receptors. In this paper we report on the synthesis of peptides corresponding to five of the seven transmembrane domains (M1-M5) and two homologues of the sixth transmembrane domain corresponding to the wild-type sequence and a mutant sequence found in a constitutively active receptor. The secondary structures of all new transmembrane peptides and previously synthesized peptides corresponding to domains 6 and 7 were assessed using a detailed CD analysis in trifluoroethanol, trifluoroethanol-water mixtures, sodium dodecyl sulfate micelles, and dimyristoyl phosphatidyl choline bilayers. Tryptophan fluorescence quenching experiments were used to assess the penetration of the membrane peptides into lipid bilayers. All peptides were predominantly (40-80%) helical in trifluoroethanol and most trifluoroethanol-water mixtures. In contrast, two of the peptides M3-35 (KKKNIIQVLLVASIETSLVFQIKVIFTGDNFKKKG) and M6-31 (KQFDSFHILLINleSAQSLLVPSIIFILAYSLK) formed stable beta-sheet structures in both sodium dodecyl sulfate micelles and DMPC bilayers. Polyacrylamide gel electrophoresis showed that these two peptides formed high molecular aggregates in the presence of SDS whereas all other peptides moved as monomeric species. The peptide (KKKFDSFHILLIMSAQSLLVLSIIFILAYSLKKKS) corresponding to the sequence in the constitutive mutant was predominantly helical under a variety of conditions, whereas the homologous wild-type sequence (KKKFDSFHILLIMSAQSLLVPSIIFILAYSLKKKS) retained a tendency to form beta-structures. These results demonstrate a connection between a conformational shift in secondary structure, as detected by biophysical techniques, and receptor function. The aggregation of particular transmembrane domains may also reflect a tendency for intermolecular interactions that occur in the membrane environment facilitating formation of receptor dimers or multimers.
Explore the source record for details and available documents.
Explore the source record for details and available documents.
We have identified a gene (SUPH) of S. cerevisiae that is required for both RAS function and mating by cells of a mating type. supH is allelic to ste16, a gene required for the production of the mating pheromone a-factor. Both RAS and a-factor coding sequences terminate with the potential acyltransferase recognition sequence Cys-A-A-X, where A is an aliphatic amino acid. Mutations in SUPH-STE16 prevent the membrane localization and maturation of RAS protein, as well as the fatty acid acylation of it and other membrane proteins. We propose the designation RAM (RAS protein and a-factor maturation function) for SUPH and STE16. RAM may encode an enzyme responsible for the modification and membrane localization of proteins with this C-terminal sequence.
Problems of delineation of population units and sub-units and the poor fit of genetic models make populations with high mobility and low stability difficult to analyze by present means. Examination of three processes īn-migration, admixture, and dispersal as well as the mate selection factors involved in out-mating and changing population boundaries are suggested as alternate procedures in these cases. The Papago Indian community of Ajo, Arizona, is characterized by historical instability, an in-migration rate of 72.3%, a dispersal rate of 20.6%, and an admixture rate of 36.7%. In-migrant parents continue to come from all parts of the reservation, reservation ties are strong, and families often fragmented between reservation and Ajo homes. For these and other reasons the community cannot be delineated as a population unit nor incorporated into models of subdivided populations. Ajo's function as a cauldron in which genes are mixed and from which they are scattered is evident in sharp increases in the percentage of mixed Papagos among residents and out-migrants. Among the latter more than twice as many mixed Papago leave Ajo as entered in the parental generation. Mate selection factors possibly involved in admixture are considered.